![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) ![]() |
![]() | Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein) Pfam PF00252 |
![]() | Protein Ribosomal protein L16p [117889] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [143200] (29 PDB entries) Uniprot P0ADY7 1-136 |
![]() | Domain d2qoxm1: 2qox M:1-136 [151076] Other proteins in same PDB: d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi1, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn |
PDB Entry: 2qox (more details), 3.93 Å
SCOPe Domain Sequences for d2qoxm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoxm1 d.41.4.2 (M:1-136) Ribosomal protein L16p {Escherichia coli [TaxId: 562]} mlqpkrtkfrkmhkgrnrglaqgtdvsfgsfglkavgrgrltarqieaarramtravkrq gkiwirvfpdkpitekplavrmgkgkgnveywvaliqpgkvlyemdgvpeelareafkla aaklpikttfvtktvm
Timeline for d2qoxm1:
![]() Domains from other chains: (mouse over for more information) d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi1, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1 |