Lineage for d2qoxi1 (2qox I:73-141)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763169Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 763170Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 763171Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 763229Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 763247Domain d2qoxi1: 2qox I:73-141 [151071]
    Other proteins in same PDB: d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1
    automatically matched to 2AW4 I:73-141
    complexed with mg, zn

Details for d2qoxi1

PDB Entry: 2qox (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 50S subunit of the second 70S ribosome. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOP Domain Sequences for d2qoxi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qoxi1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOP Domain Coordinates for d2qoxi1:

Click to download the PDB-style file with coordinates for d2qoxi1.
(The format of our PDB-style files is described here.)

Timeline for d2qoxi1: