Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
Species Escherichia coli [TaxId:562] [158349] (29 PDB entries) Uniprot P0A7J7 73-141 |
Domain d2qoxi1: 2qox I:73-141 [151071] Other proteins in same PDB: d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxi2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn |
PDB Entry: 2qox (more details), 3.93 Å
SCOPe Domain Sequences for d2qoxi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoxi1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]} ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta rsmglvved
Timeline for d2qoxi1:
View in 3D Domains from other chains: (mouse over for more information) d2qox01, d2qox11, d2qox31, d2qox41, d2qoxc1, d2qoxc2, d2qoxd1, d2qoxe1, d2qoxf1, d2qoxg1, d2qoxg2, d2qoxh1, d2qoxh2, d2qoxj1, d2qoxk1, d2qoxl1, d2qoxm1, d2qoxn1, d2qoxo1, d2qoxp1, d2qoxq1, d2qoxr1, d2qoxs1, d2qoxt1, d2qoxu1, d2qoxv1, d2qoxw1, d2qoxx1, d2qoxy1, d2qoxz1 |