Lineage for d2qj2a1 (2qj2 A:36-126)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033062Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 3033063Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 3033064Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. 3033065Protein Hepatocyte growth factor [57416] (1 species)
    heparin-binding domain
  7. 3033066Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)
  8. 3033070Domain d2qj2a1: 2qj2 A:36-126 [150817]
    Other proteins in same PDB: d2qj2a2, d2qj2b2
    automated match to d1bhta1
    complexed with so4

Details for d2qj2a1

PDB Entry: 2qj2 (more details), 1.81 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d2qj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qj2a1 g.10.1.1 (A:36-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

SCOPe Domain Coordinates for d2qj2a1:

Click to download the PDB-style file with coordinates for d2qj2a1.
(The format of our PDB-style files is described here.)

Timeline for d2qj2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qj2a2