PDB entry 2qj2

View 2qj2 on RCSB PDB site
Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist
Class: hormone
Keywords: hgf/sf, hormone/growth factor
Deposited on 2007-07-06, released 2007-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.201
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HGF, HPTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qj2a1, d2qj2a2
  • Chain 'B':
    Compound: hepatocyte growth factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HGF, HPTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2qj2b1, d2qj2b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2qj2A (A:)
    gsyaegqrkrrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftck
    afvfdkarkqclwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitks
    gikcqpwssmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipq
    csev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qj2A (A:)
    rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
    clwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwssm
    iphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2qj2B (B:)
    gsyaegqrkrrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftck
    afvfdkarkqclwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitks
    gikcqpwssmiphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipq
    csev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2qj2B (B:)
    rrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkark
    qclwfpfnsmssgvkkefghefdlyenkdyirnciigkgrsykgtvsitksgikcqpwss
    miphehsflpssyrgkdlqenycrnprgeeggpwcftsnpevryevcdipqcsev