Lineage for d2qj2a2 (2qj2 A:127-209)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033286Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 3033287Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)
  8. 3033292Domain d2qj2a2: 2qj2 A:127-209 [150818]
    Other proteins in same PDB: d2qj2a1, d2qj2b1
    automated match to d1bhta2
    complexed with so4

Details for d2qj2a2

PDB Entry: 2qj2 (more details), 1.81 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d2qj2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qj2a2 g.14.1.1 (A:127-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
nciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeegg
pwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d2qj2a2:

Click to download the PDB-style file with coordinates for d2qj2a2.
(The format of our PDB-style files is described here.)

Timeline for d2qj2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qj2a1