SCOP 1.75: Domain d2qj2a1: 2qj2 A:36-126

Lineage for d2qj2a1 (2qj2 A:36-126)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein)

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (7 PDB entries)

8. Domain d2qj2a1: 2qj2 A:36-126 [150817]
   Other proteins in same PDB: d2qj2a2, d2qj2b2
   automatically matched to d2hgfa_
   complexed with so4

Details for d2qj2a1

PDB Entry: 2qj2, 1.81 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist

PDB Compounds: (A:) hepatocyte growth factor

SCOP Domain Sequences for d2qj2a1:

Sequence; same for both SEQRES and ATOM records:

>d2qj2a1 g.10.1.1 (A:36-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

Timeline for d2qj2a1:

• d2qj2a1 is new in SCOP 1.75
  
• d2qj2a1 appears in SCOPe 2.01
  
• d2qj2a1 appears in the current release, SCOPe 2.08