Class g: Small proteins [56992] (90 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein) |
Protein Hepatocyte growth factor [57416] (1 species) heparin-binding domain |
Species Human (Homo sapiens) [TaxId:9606] [57417] (7 PDB entries) |
Domain d2qj2a1: 2qj2 A:36-126 [150817] Other proteins in same PDB: d2qj2a2, d2qj2b2 automatically matched to d2hgfa_ complexed with so4 |
PDB Entry: 2qj2 (more details), 1.81 Å
SCOP Domain Sequences for d2qj2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qj2a1 g.10.1.1 (A:36-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq clwfpfnsmssgvkkefghefdlyenkdyir
Timeline for d2qj2a1: