SCOPe 2.08: Domain d2qj2b1: 2qj2 B:1035-1126

Lineage for d2qj2b1 (2qj2 B:1035-1126)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)

8. Domain d2qj2b1: 2qj2 B:1035-1126 [150819]
   Other proteins in same PDB: d2qj2a2, d2qj2b2
   automated match to d1bhta1
   complexed with so4

Details for d2qj2b1

PDB Entry: 2qj2, 1.81 Å

PDB Description: A Mechanistic Basis for Converting a Receptor Tyrosine Kinase Agonist to an Antagonist

PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d2qj2b1:

Sequence; same for both SEQRES and ATOM records:

>d2qj2b1 g.10.1.1 (B:1035-1126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkark
qclwfpfnsmssgvkkefghefdlyenkdyir

Timeline for d2qj2b1:

• d2qj2b1 first appeared in SCOP 1.75
  
• d2qj2b1 appears in SCOPe 2.07