![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
![]() | Protein Leukemia inhibitory factor (LIF) [47274] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63529] (3 PDB entries) |
![]() | Domain d2q7nb1: 2q7n B:12-180 [150094] automatically matched to d1pvhb_ complexed with nag |
PDB Entry: 2q7n (more details), 4 Å
SCOPe Domain Sequences for d2q7nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q7nb1 a.26.1.1 (B:12-180) Leukemia inhibitory factor (LIF) {Human (Homo sapiens) [TaxId: 9606]} cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf
Timeline for d2q7nb1: