SCOPe 2.07: Domain d2q7nb1: 2q7n B:12-180

Lineage for d2q7nb1 (2q7n B:12-180)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Leukemia inhibitory factor (LIF) [47274] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63529] (3 PDB entries)

8. Domain d2q7nb1: 2q7n B:12-180 [150094]
   automatically matched to d1pvhb_
   complexed with nag

Details for d2q7nb1

PDB Entry: 2q7n, 4 Å

PDB Description: crystal structure of leukemia inhibitory factor in complex with lif receptor (domains 1-5)

PDB Compounds: (B:) leukemia inhibitory factor

SCOPe Domain Sequences for d2q7nb1:

Sequence; same for both SEQRES and ATOM records:

>d2q7nb1 a.26.1.1 (B:12-180) Leukemia inhibitory factor (LIF) {Human (Homo sapiens) [TaxId: 9606]}
cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh
angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc
rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf

Timeline for d2q7nb1:

• d2q7nb1 first appeared in SCOP 1.75
  
• d2q7nb1 appears in SCOPe 2.06
  
• d2q7nb1 appears in the current release, SCOPe 2.08