Lineage for d2q7nb1 (2q7n B:12-180)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992769Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1992770Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1992771Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1992829Protein Leukemia inhibitory factor (LIF) [47274] (2 species)
  7. 1992830Species Human (Homo sapiens) [TaxId:9606] [63529] (3 PDB entries)
  8. 1992834Domain d2q7nb1: 2q7n B:12-180 [150094]
    automatically matched to d1pvhb_
    complexed with nag

Details for d2q7nb1

PDB Entry: 2q7n (more details), 4 Å

PDB Description: crystal structure of leukemia inhibitory factor in complex with lif receptor (domains 1-5)
PDB Compounds: (B:) leukemia inhibitory factor

SCOPe Domain Sequences for d2q7nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q7nb1 a.26.1.1 (B:12-180) Leukemia inhibitory factor (LIF) {Human (Homo sapiens) [TaxId: 9606]}
cairhpchnnlmnqirsqlaqlngsanalfilyytaqgepfpnnldklcgpnvtdfppfh
angtekaklvelyrivvylgtslgnitrdqkilnpsalslhsklnatadilrgllsnvlc
rlcskyhvghvdvtygpdtsgkdvfqkkklgcqllgkykqiiavlaqaf

SCOPe Domain Coordinates for d2q7nb1:

Click to download the PDB-style file with coordinates for d2q7nb1.
(The format of our PDB-style files is described here.)

Timeline for d2q7nb1: