![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Putative regulatory protein Sco4313 [158254] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [158255] (1 PDB entry) Uniprot Q9KXS8 8-86 |
![]() | Domain d2oi8a1: 2oi8 A:8-86 [148778] Other proteins in same PDB: d2oi8a2 |
PDB Entry: 2oi8 (more details), 2.5 Å
SCOPe Domain Sequences for d2oi8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]} tpreryrtqvraeikdhaweqiatagasalslnaiakrmgmsgpalyryfdgrdelitel irdayrsqadslraaaasg
Timeline for d2oi8a1: