Lineage for d2oi8a2 (2oi8 A:87-216)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Putative regulatory protein Sco4313 [158800] (1 species) Species Streptomyces coelicolor [TaxId:1902] [158801] (1 PDB entry)
Uniprot Q9KXS8 87-216
Domain d2oi8a2: 2oi8 A:87-216 [148779]
Other proteins in same PDB: d2oi8a1
Details for d2oi8a2
PDB Entry: 2oi8 (more details), 2.5 Å
PDB Description: Crystal structure of putative regulatory protein SCO4313
PDB Compounds: (A:) Putative regulatory protein SCO4313SCOPe Domain Sequences for d2oi8a2:
Sequence, based on SEQRES records: (download)
>d2oi8a2 a.121.1.1 (A:87-216) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]}
adlaglahalrawalddpqryflifgtpvpgyrapdditeiaaetmavivdacaalppsd
gtdgafdahldthrqwagdrpapssalhralsfwsrlhgvlslelagqftgmgfdsallf
eaelkdllgp
Sequence, based on observed residues (ATOM records): (download)
>d2oi8a2 a.121.1.1 (A:87-216) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]}
adlaglahalrawalddpqryflifgtpvpgyrapdditeiaaetmavivdacaagtdga
fdahldthrqwadrpapssalhralsfwsrlhgvlslelagqftgmgfdsallfeaelkd
llgp
SCOPe Domain Coordinates for d2oi8a2:
Click to download the PDB-style file with coordinates for d2oi8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2oi8a2:
- d2oi8a2 first appeared in SCOP 1.75
- d2oi8a2 appears in SCOPe 2.07
View in 3D
