Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins) Pfam PF00605 |
Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116792] (3 PDB entries) Uniprot Q14653 3-112 |
Domain d2o6gg_: 2o6g G: [148630] automated match to d2pi0b_ protein/DNA complex |
PDB Entry: 2o6g (more details), 3.1 Å
SCOPe Domain Sequences for d2o6gg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6gg_ a.4.5.23 (G:) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens) [TaxId: 9606]} tpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatg ayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns
Timeline for d2o6gg_: