PDB entry 2o6g

View 2o6g on RCSB PDB site
Description: Crystal structure of IRF-3 bound to the interferon-b enhancer
Class: transcription/DNA
Keywords: protein-DNA complex, transcription-DNA complex
Deposited on 2006-12-07, released 2007-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: interferon-b enhancer
  • Chain 'D':
    Compound: interferon-b enhancer
  • Chain 'E':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o6ge_
  • Chain 'F':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o6gf_
  • Chain 'G':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o6gg_
  • Chain 'H':
    Compound: Interferon regulatory factor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: IRF3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2o6gh_

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2o6gE (E:)
    mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea
    tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvnsgvgdfsqp
    dts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6gE (E:)
    tpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatg
    ayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2o6gF (F:)
    mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea
    tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvnsgvgdfsqp
    dts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6gF (F:)
    pkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatga
    yvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2o6gG (G:)
    mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea
    tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvnsgvgdfsqp
    dts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6gG (G:)
    tpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatg
    ayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2o6gH (H:)
    mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea
    tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvnsgvgdfsqp
    dts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2o6gH (H:)
    pkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatga
    yvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvn