Lineage for d2o6gh_ (2o6g H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693544Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
    Pfam PF00605
  6. 2693549Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species)
  7. 2693550Species Human (Homo sapiens) [TaxId:9606] [116792] (3 PDB entries)
    Uniprot Q14653 3-112
  8. 2693560Domain d2o6gh_: 2o6g H: [148631]
    automated match to d2pi0b_
    protein/DNA complex

Details for d2o6gh_

PDB Entry: 2o6g (more details), 3.1 Å

PDB Description: crystal structure of irf-3 bound to the interferon-b enhancer
PDB Compounds: (H:) Interferon regulatory factor 3

SCOPe Domain Sequences for d2o6gh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6gh_ a.4.5.23 (H:) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens) [TaxId: 9606]}
pkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatga
yvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvn

SCOPe Domain Coordinates for d2o6gh_:

Click to download the PDB-style file with coordinates for d2o6gh_.
(The format of our PDB-style files is described here.)

Timeline for d2o6gh_: