Lineage for d2jj1n_ (2jj1 N:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2880867Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2881030Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2881031Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 2881032Protein F1 ATP synthase gamma subunit [52945] (4 species)
  7. 2881047Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
    Uniprot P05631
  8. 2881057Domain d2jj1n_: 2jj1 N: [148124]
    Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1i1, d2jj1i2, d2jj1i3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3
    automated match to d1bmfg_
    complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1n_

PDB Entry: 2jj1 (more details), 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.
PDB Compounds: (N:) ATP synthase gamma chain

SCOPe Domain Sequences for d2jj1n_:

Sequence, based on SEQRES records: (download)

>d2jj1n_ c.49.2.1 (N:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d2jj1n_ c.49.2.1 (N:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgssdrglcgaihss
vakqmigvgdkirsikevgrrpptfgdifnrfrsvisykteyslaniiyyslkesttseq
sarmtamdnasknasemidkltltfnrtrqavitkelieiisgaaal

SCOPe Domain Coordinates for d2jj1n_:

Click to download the PDB-style file with coordinates for d2jj1n_.
(The format of our PDB-style files is described here.)

Timeline for d2jj1n_: