SCOPe 2.08: Domain d2jj1k2: 2jj1 K:82-357

Lineage for d2jj1k2 (2jj1 K:82-357)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
   Uniprot P00829

8. Domain d2jj1k2: 2jj1 K:82-357 [198149]
   Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d3, d2jj1e1, d2jj1e3, d2jj1f1, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1i1, d2jj1i2, d2jj1i3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k3, d2jj1l1, d2jj1l3, d2jj1m1, d2jj1m3, d2jj1n_
   automated match to d1e79d3
   complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1k2

PDB Entry: 2jj1, 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.

PDB Compounds: (K:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj1k2:

Sequence; same for both SEQRES and ATOM records:

>d2jj1k2 c.37.1.11 (K:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

Timeline for d2jj1k2:

• d2jj1k2 first appeared in SCOPe 2.03
  
• d2jj1k2 appears in SCOPe 2.07