Lineage for d2jj1d2 (2jj1 D:82-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869423Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2869554Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)
  7. 2869603Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
    Uniprot P00829
  8. 2869628Domain d2jj1d2: 2jj1 D:82-357 [198140]
    Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d3, d2jj1e1, d2jj1e3, d2jj1f1, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1i1, d2jj1i2, d2jj1i3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k3, d2jj1l1, d2jj1l3, d2jj1m1, d2jj1m3, d2jj1n_
    automated match to d1e79d3
    complexed with adp, anp, azi, gol, mg, pit, po4

Details for d2jj1d2

PDB Entry: 2jj1 (more details), 2.7 Å

PDB Description: the structure of f1-atpase inhibited by piceatannol.
PDB Compounds: (D:) ATP synthase subunit beta

SCOPe Domain Sequences for d2jj1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jj1d2 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d2jj1d2:

Click to download the PDB-style file with coordinates for d2jj1d2.
(The format of our PDB-style files is described here.)

Timeline for d2jj1d2: