![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein automated matches [190393] (12 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [255271] (6 PDB entries) |
![]() | Domain d2jj1i2: 2jj1 I:95-379 [238735] Other proteins in same PDB: d2jj1a1, d2jj1a3, d2jj1b1, d2jj1b3, d2jj1c1, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h3, d2jj1i1, d2jj1i3, d2jj1j1, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_ automated match to d1maba3 complexed with adp, anp, azi, gol, mg, pit, po4 |
PDB Entry: 2jj1 (more details), 2.7 Å
SCOPe Domain Sequences for d2jj1i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj1i2 c.37.1.11 (I:95-379) automated matches {Cow (Bos taurus) [TaxId: 9913]} vdvpvgeellgrvvdalgnaidgkgpigskarrrvglkapgiiprisvrepmqtgikavd slvpigrgqreliigdrqtgktsiaidtiinqkrfndgtdekkklyciyvaigqkrstva qlvkrltdadamkytivvsatasdaaplqylapysgcsmgeyfrdngkhaliiyddlskq avayrqmslllrrppgreaypgdvfylhsrlleraakmndafgggsltalpvietqagdv sayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq
Timeline for d2jj1i2:
![]() Domains from other chains: (mouse over for more information) d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_ |