![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (17 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries) |
![]() | Domain d2jj1i3: 2jj1 I:380-509 [238736] Other proteins in same PDB: d2jj1a1, d2jj1a2, d2jj1b1, d2jj1b2, d2jj1c1, d2jj1c2, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1i1, d2jj1i2, d2jj1j1, d2jj1j2, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_ automated match to d1maba1 complexed with adp, anp, azi, gol, mg, pit, po4 |
PDB Entry: 2jj1 (more details), 2.7 Å
SCOPe Domain Sequences for d2jj1i3:
Sequence, based on SEQRES records: (download)
>d2jj1i3 a.69.1.0 (I:380-509) automated matches {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke ivtnflagfe
>d2jj1i3 a.69.1.0 (I:380-509) automated matches {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya gvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklkeivtnflag fe
Timeline for d2jj1i3:
![]() Domains from other chains: (mouse over for more information) d2jj1a1, d2jj1a2, d2jj1a3, d2jj1b1, d2jj1b2, d2jj1b3, d2jj1c1, d2jj1c2, d2jj1c3, d2jj1d1, d2jj1d2, d2jj1d3, d2jj1e1, d2jj1e2, d2jj1e3, d2jj1f1, d2jj1f2, d2jj1f3, d2jj1g_, d2jj1h1, d2jj1h2, d2jj1h3, d2jj1j1, d2jj1j2, d2jj1j3, d2jj1k1, d2jj1k2, d2jj1k3, d2jj1l1, d2jj1l2, d2jj1l3, d2jj1m1, d2jj1m2, d2jj1m3, d2jj1n_ |