SCOPe 2.08: Domain d2c38o2: 2c38 O:192-275

Lineage for d2c38o2 (2c38 O:192-275)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries)

8. Domain d2c38o2: 2c38 O:192-275 [146305]
   Other proteins in same PDB: d2c38a1, d2c38b1, d2c38b2, d2c38c1, d2c38d1, d2c38d2, d2c38e1, d2c38f1, d2c38f2, d2c38g1, d2c38h1, d2c38h2, d2c38i1, d2c38j1, d2c38j2, d2c38k1, d2c38l1, d2c38l2, d2c38m1, d2c38n1, d2c38n2, d2c38o1, d2c38p1, d2c38p2, d2c38q1, d2c38r1, d2c38r2, d2c38s1, d2c38t1, d2c38t2, d2c38u1, d2c38v1, d2c38v2, d2c38w1, d2c38x1, d2c38x2
   automated match to d2je6a2
   protein/RNA complex; complexed with amp, cl

Details for d2c38o2

PDB Entry: 2c38, 3.1 Å

PDB Description: rnase ph core of the archaeal exosome in complex with a5 rna

PDB Compounds: (O:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c38o2:

Sequence; same for both SEQRES and ATOM records:

>d2c38o2 d.101.1.0 (O:192-275) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

Timeline for d2c38o2:

• d2c38o2 first appeared in SCOP 1.75
  
• d2c38o2 appears in SCOPe 2.07