Lineage for d2c38s1 (2c38 S:1-191)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930318Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2930461Protein automated matches [232811] (2 species)
    not a true protein
  7. 2930469Species Sulfolobus solfataricus [TaxId:2287] [232812] (4 PDB entries)
  8. 2930506Domain d2c38s1: 2c38 S:1-191 [146312]
    Other proteins in same PDB: d2c38a2, d2c38b1, d2c38b2, d2c38c2, d2c38d1, d2c38d2, d2c38e2, d2c38f1, d2c38f2, d2c38g2, d2c38h1, d2c38h2, d2c38i2, d2c38j1, d2c38j2, d2c38k2, d2c38l1, d2c38l2, d2c38m2, d2c38n1, d2c38n2, d2c38o2, d2c38p1, d2c38p2, d2c38q2, d2c38r1, d2c38r2, d2c38s2, d2c38t1, d2c38t2, d2c38u2, d2c38v1, d2c38v2, d2c38w2, d2c38x1, d2c38x2
    automated match to d2je6a1
    protein/RNA complex; complexed with amp, cl

Details for d2c38s1

PDB Entry: 2c38 (more details), 3.1 Å

PDB Description: rnase ph core of the archaeal exosome in complex with a5 rna
PDB Compounds: (S:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c38s1:

Sequence, based on SEQRES records: (download)

>d2c38s1 d.14.1.4 (S:1-191) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2c38s1 d.14.1.4 (S:1-191) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
nevvgkl

SCOPe Domain Coordinates for d2c38s1:

Click to download the PDB-style file with coordinates for d2c38s1.
(The format of our PDB-style files is described here.)

Timeline for d2c38s1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c38s2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38n1, d2c38n2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2