![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
![]() | Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins) |
![]() | Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [160591] (9 PDB entries) Uniprot Q9UXC2 156-241! Uniprot Q9UXC2 156-248 |
![]() | Domain d2c38n2: 2c38 N:156-248 [146303] Other proteins in same PDB: d2c38a1, d2c38a2, d2c38b1, d2c38c1, d2c38c2, d2c38d1, d2c38e1, d2c38e2, d2c38f1, d2c38g1, d2c38g2, d2c38h1, d2c38i1, d2c38i2, d2c38j1, d2c38k1, d2c38k2, d2c38l1, d2c38m1, d2c38m2, d2c38n1, d2c38o1, d2c38o2, d2c38p1, d2c38q1, d2c38q2, d2c38r1, d2c38s1, d2c38s2, d2c38t1, d2c38u1, d2c38u2, d2c38v1, d2c38w1, d2c38w2, d2c38x1 automatically matched to 2BR2 B:156-248 protein/RNA complex; complexed with amp, cl |
PDB Entry: 2c38 (more details), 3.1 Å
SCOPe Domain Sequences for d2c38n2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c38n2 d.101.1.1 (N:156-248) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} pmrdliagvavgkadgviildlnetedmwgeadmpiammpslnqvtlfqlngsmtpdefr qafdlavkginiiynlerealkskyvefkeegv
Timeline for d2c38n2:
![]() Domains from other chains: (mouse over for more information) d2c38a1, d2c38a2, d2c38b1, d2c38b2, d2c38c1, d2c38c2, d2c38d1, d2c38d2, d2c38e1, d2c38e2, d2c38f1, d2c38f2, d2c38g1, d2c38g2, d2c38h1, d2c38h2, d2c38i1, d2c38i2, d2c38j1, d2c38j2, d2c38k1, d2c38k2, d2c38l1, d2c38l2, d2c38m1, d2c38m2, d2c38o1, d2c38o2, d2c38p1, d2c38p2, d2c38q1, d2c38q2, d2c38r1, d2c38r2, d2c38s1, d2c38s2, d2c38t1, d2c38t2, d2c38u1, d2c38u2, d2c38v1, d2c38v2, d2c38w1, d2c38w2, d2c38x1, d2c38x2 |