SCOPe 2.08: Domain d1xbpm1: 1xbp M:8-111

Lineage for d1xbpm1 (1xbp M:8-111)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein L18 (L18p) [53139] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159643] (6 PDB entries)
   Uniprot Q9RSL2 8-111

8. Domain d1xbpm1: 1xbp M:8-111 [145878]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR L:8-111
   complexed with mul
   has additional insertions and/or extensions that are not grouped together

Details for d1xbpm1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (M:) 50S ribosomal protein L18

SCOPe Domain Sequences for d1xbpm1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpm1 c.55.4.1 (M:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]}
rrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgnktdt
aaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaaregg

Timeline for d1xbpm1:

• d1xbpm1 first appeared in SCOP 1.75
  
• d1xbpm1 appears in SCOPe 2.07