Lineage for d1xbpi1 (1xbp I:2-133)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787772Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2787773Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2787774Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2787775Protein Ribosomal protein L14 [50195] (5 species)
  7. 2787778Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
    Uniprot Q9RXJ2 1-134
  8. 2787784Domain d1xbpi1: 1xbp I:2-133 [145875]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR H:1-134
    complexed with mul

Details for d1xbpi1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (I:) 50S ribosomal protein L14

SCOPe Domain Sequences for d1xbpi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpi1 b.39.1.1 (I:2-133) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
rfmkivslapev

SCOPe Domain Coordinates for d1xbpi1:

Click to download the PDB-style file with coordinates for d1xbpi1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpi1: