![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.301: L35p-like [143033] (1 superfamily) core: alpha-beta(3)-alpha; 2layers a/b |
![]() | Superfamily d.301.1: L35p-like [143034] (1 family) ![]() automatically mapped to Pfam PF01632 |
![]() | Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein) Pfam PF01632 |
![]() | Protein Ribosomal protein L35p [143036] (3 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries) Uniprot Q9RSW6 2-64 |
![]() | Domain d1xbp31: 1xbp 3:2-64 [145863] Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 automatically matched to 2ZJR 3:2-64 complexed with mul |
PDB Entry: 1xbp (more details), 3.5 Å
SCOPe Domain Sequences for d1xbp31:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbp31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]} pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm lpr
Timeline for d1xbp31:
![]() Domains from other chains: (mouse over for more information) d1xbp11, d1xbp21, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 |