![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
![]() | Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein) Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members |
![]() | Protein Ribosomal protein L33p [144204] (3 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [161179] (6 PDB entries) Uniprot Q9RSS4 2-54 |
![]() | Domain d1xbp11: 1xbp 1:2-54 [145861] Other proteins in same PDB: d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 automatically matched to 2ZJR 1:2-54 complexed with mul |
PDB Entry: 1xbp (more details), 3.5 Å
SCOPe Domain Sequences for d1xbp11:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbp11 g.41.8.6 (1:2-54) Ribosomal protein L33p {Deinococcus radiodurans [TaxId: 1299]} akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk
Timeline for d1xbp11:
![]() Domains from other chains: (mouse over for more information) d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 |