Lineage for d1xbpm1 (1xbp M:8-111)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 837367Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 837368Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 837369Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 837413Species Deinococcus radiodurans [TaxId:1299] [159643] (6 PDB entries)
    Uniprot Q9RSL2 8-111
  8. 837415Domain d1xbpm1: 1xbp M:8-111 [145878]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR L:8-111
    complexed with mul

Details for d1xbpm1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (M:) 50S ribosomal protein L18

SCOP Domain Sequences for d1xbpm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpm1 c.55.4.1 (M:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]}
rrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgnktdt
aaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaaregg

SCOP Domain Coordinates for d1xbpm1:

Click to download the PDB-style file with coordinates for d1xbpm1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpm1: