Lineage for d2j59m1 (2j59 M:931-1063)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803250Protein Rho GTPase-activating protein 21 [159213] (1 species)
  7. 2803251Species Human (Homo sapiens) [TaxId:9606] [159214] (1 PDB entry)
    Uniprot Q5T5U3 931-1063
  8. 2803252Domain d2j59m1: 2j59 M:931-1063 [145656]
    Other proteins in same PDB: d2j59a2, d2j59a3, d2j59b2, d2j59b3, d2j59c2, d2j59c3, d2j59d2, d2j59d3, d2j59e2, d2j59e3, d2j59f2, d2j59f3
    complexed with dio, edo, gtp, mg, so4
    has additional insertions and/or extensions that are not grouped together

Details for d2j59m1

PDB Entry: 2j59 (more details), 2.1 Å

PDB Description: crystal structure of the arf1:arhgap21-arfbd complex
PDB Compounds: (M:) rho-gtpase activating protein 10

SCOPe Domain Sequences for d2j59m1:

Sequence, based on SEQRES records: (download)

>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpisv
naclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvtnr
dlisrrikeynnl

Sequence, based on observed residues (ATOM records): (download)

>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvpwkqmyvvlrghslylykdkreqpisvnaclidisysetkrknvfrl
ttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl

SCOPe Domain Coordinates for d2j59m1:

Click to download the PDB-style file with coordinates for d2j59m1.
(The format of our PDB-style files is described here.)

Timeline for d2j59m1: