PDB entry 2j59

View 2j59 on RCSB PDB site
Description: crystal structure of the arf1:arhgap21-arfbd complex
Class: hydrolase
Keywords: arf, arf1, arfbd, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase, protein transport, actin organization, small GTP-binding protein, golgi apparatus
Deposited on 2006-09-13, released 2007-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J59 (0-1)
      • engineered mutation (55)
    • Uniprot P84078 (2-End)
    Domains in SCOPe 2.07: d2j59a2, d2j59a3
  • Chain 'B':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J59 (0-1)
      • engineered mutation (55)
    • Uniprot P84078 (2-End)
    Domains in SCOPe 2.07: d2j59b2, d2j59b3
  • Chain 'C':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J59 (0-1)
      • engineered mutation (55)
    • Uniprot P84078 (2-End)
    Domains in SCOPe 2.07: d2j59c2, d2j59c3
  • Chain 'D':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J59 (0-1)
      • engineered mutation (55)
    • Uniprot P84078 (2-End)
    Domains in SCOPe 2.07: d2j59d2, d2j59d3
  • Chain 'E':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J59 (0-1)
      • engineered mutation (55)
    • Uniprot P84078 (2-End)
    Domains in SCOPe 2.07: d2j59e2, d2j59e3
  • Chain 'F':
    Compound: ADP-ribosylation factor 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J59 (0-1)
      • engineered mutation (55)
    • Uniprot P84078 (2-End)
    Domains in SCOPe 2.07: d2j59f2, d2j59f3
  • Chain 'M':
    Compound: rho-gtpase activating protein 10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j59m1
  • Chain 'N':
    Compound: rho-gtpase activating protein 10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j59n_
  • Chain 'O':
    Compound: rho-gtpase activating protein 10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j59o_
  • Chain 'P':
    Compound: rho-gtpase activating protein 10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j59p_
  • Chain 'Q':
    Compound: rho-gtpase activating protein 10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j59q_
  • Chain 'R':
    Compound: rho-gtpase activating protein 10
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j59r_
  • Heterogens: GTP, MG, DIO, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j59A (A:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59A (A:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j59B (B:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59B (B:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j59C (C:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59C (C:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j59D (D:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59D (D:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j59E (E:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59E (E:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j59F (F:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59F (F:)
    gsmrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkir
    plwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamn
    aaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2j59M (M:)
    sdaakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpi
    svnaclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvt
    nrdlisrrikeynnlmskaeqlpktprqslsirqtllgaksepktqsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59M (M:)
    aakegwlhfrplvpwkqmyvvlrghslylykdkreqpisvnaclidisysetkrknvfrl
    ttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2j59N (N:)
    sdaakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpi
    svnaclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvt
    nrdlisrrikeynnlmskaeqlpktprqslsirqtllgaksepktqsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59N (N:)
    aakegwlhfrplvpwkqmyvvlrghslylykdkreqqpisvnaclidisysetkrknvfr
    lttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2j59O (O:)
    sdaakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpi
    svnaclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvt
    nrdlisrrikeynnlmskaeqlpktprqslsirqtllgaksepktqsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59O (O:)
    aakegwlhfrplvpwkqmyvvlrghslylykdkreqpisvnaclidisysetkrknvfrl
    ttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeyn
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2j59P (P:)
    sdaakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpi
    svnaclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvt
    nrdlisrrikeynnlmskaeqlpktprqslsirqtllgaksepktqsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59P (P:)
    aakegwlhfrplvpwkqmyvvlrghslylykdkreqqpisvnaclidisysetkrknvfr
    lttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2j59Q (Q:)
    sdaakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpi
    svnaclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvt
    nrdlisrrikeynnlmskaeqlpktprqslsirqtllgaksepktqsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59Q (Q:)
    aakegwlhfrplvpwkqmyvvlrghslylykdkreqqpisvnaclidisysetkrknvfr
    lttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2j59R (R:)
    sdaakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpi
    svnaclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvt
    nrdlisrrikeynnlmskaeqlpktprqslsirqtllgaksepktqsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j59R (R:)
    aakegwlhfrplvpwkqmyvvlrghslylykdkreqpisvnaclidisysetkrknvfrl
    ttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl