SCOPe 2.08: Domain d2j59p_: 2j59 P:

Lineage for d2j59p_ (2j59 P:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Rho GTPase-activating protein 21 [159213] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159214] (1 PDB entry)
   Uniprot Q5T5U3 931-1063

8. Domain d2j59p_: 2j59 P: [145659]
   Other proteins in same PDB: d2j59a2, d2j59a3, d2j59b2, d2j59b3, d2j59c2, d2j59c3, d2j59d2, d2j59d3, d2j59e2, d2j59e3, d2j59f2, d2j59f3
   automated match to d2j59m1
   complexed with dio, edo, gtp, mg, so4
   has additional insertions and/or extensions that are not grouped together

Details for d2j59p_

PDB Entry: 2j59, 2.1 Å

PDB Description: crystal structure of the arf1:arhgap21-arfbd complex

PDB Compounds: (P:) rho-gtpase activating protein 10

SCOPe Domain Sequences for d2j59p_:

Sequence, based on SEQRES records:

>d2j59p_ b.55.1.1 (P:) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttpseeeqpisv
naclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlneedtgvtnr
dlisrrikeynnl

Sequence, based on observed residues (ATOM records):

>d2j59p_ b.55.1.1 (P:) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]}
aakegwlhfrplvpwkqmyvvlrghslylykdkreqqpisvnaclidisysetkrknvfr
lttsdceclfqaedrddmlawiktiqessnlneedtgvtnrdlisrrikeynnl

Timeline for d2j59p_:

• d2j59p_ first appeared in SCOP 1.75, called d2j59p1
  
• d2j59p_ appears in SCOPe 2.07