SCOPe 2.08: Domain d2j59b2: 2j59 B:18-180

Lineage for d2j59b2 (2j59 B:18-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (17 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
   Uniprot P32889

8. Domain d2j59b2: 2j59 B:18-180 [138030]
   Other proteins in same PDB: d2j59a3, d2j59b3, d2j59c3, d2j59d3, d2j59e3, d2j59f3, d2j59m1, d2j59n_, d2j59o_, d2j59p_, d2j59q_, d2j59r_
   automated match to d1o3ya_
   complexed with dio, edo, gtp, mg, so4

Details for d2j59b2

PDB Entry: 2j59, 2.1 Å

PDB Description: crystal structure of the arf1:arhgap21-arfbd complex

PDB Compounds: (B:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d2j59b2:

Sequence; same for both SEQRES and ATOM records:

>d2j59b2 c.37.1.8 (B:18-180) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq

Timeline for d2j59b2:

• d2j59b2 first appeared in SCOP 1.73, called d2j59b1
  
• d2j59b2 appears in SCOPe 2.07