Lineage for d2j59e2 (2j59 E:18-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866676Protein ADP-ribosylation factor [52614] (17 species)
  7. 2866686Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
    Uniprot P32889
  8. 2866700Domain d2j59e2: 2j59 E:18-180 [138033]
    Other proteins in same PDB: d2j59a3, d2j59b3, d2j59c3, d2j59d3, d2j59e3, d2j59f3, d2j59m1, d2j59n_, d2j59o_, d2j59p_, d2j59q_, d2j59r_
    automated match to d1o3ya_
    complexed with dio, edo, gtp, mg, so4

Details for d2j59e2

PDB Entry: 2j59 (more details), 2.1 Å

PDB Description: crystal structure of the arf1:arhgap21-arfbd complex
PDB Compounds: (E:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d2j59e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j59e2 c.37.1.8 (E:18-180) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggldkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq

SCOPe Domain Coordinates for d2j59e2:

Click to download the PDB-style file with coordinates for d2j59e2.
(The format of our PDB-style files is described here.)

Timeline for d2j59e2: