Lineage for d2j01t1 (2j01 T:1-138)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796856Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein)
    Pfam PF01245
  6. 796857Protein Ribosomal protein L19 [141246] (3 species)
  7. 796875Species Thermus thermophilus [TaxId:274] [159030] (4 PDB entries)
    Uniprot P60490 1-138
  8. 796876Domain d2j01t1: 2j01 T:1-138 [145576]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure

Details for d2j01t1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (T:) 50S ribosomal protein L19

SCOP Domain Sequences for d2j01t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]}
mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
idqdraaeraakeeaqka

SCOP Domain Coordinates for d2j01t1:

Click to download the PDB-style file with coordinates for d2j01t1.
(The format of our PDB-style files is described here.)

Timeline for d2j01t1: