SCOP 1.75: Domain d2j0131: 2j01 3:1-60

Lineage for d2j0131 (2j01 3:1-60)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
   short-chain member of the family

7. Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries)

8. Domain d2j0131: 2j01 3:1-60 [145558]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   automatically matched to d1bxya_

Details for d2j0131

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (3:) 50S ribosomal protein L30

SCOP Domain Sequences for d2j0131:

Sequence; same for both SEQRES and ATOM records:

>d2j0131 d.59.1.1 (3:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]}
mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve

Timeline for d2j0131:

• d2j0131 is new in SCOP 1.75
  
• d2j0131 appears in SCOPe 2.01
  
• d2j0131 appears in the current release, SCOPe 2.08