Lineage for d2j0171 (2j01 7:1-49)

  1. Root: SCOP 1.75
  2. 899091Class j: Peptides [58231] (121 folds)
  3. 900906Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 900907Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 900908Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 900909Protein Ribosomal protein L34p [144323] (3 species)
  7. 900930Species Thermus thermophilus [TaxId:274] [161306] (11 PDB entries)
    Uniprot P80340 1-49
  8. 900931Domain d2j0171: 2j01 7:1-49 [145562]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    Representative structure

Details for d2j0171

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (7:) 50S ribosomal protein L34

SCOP Domain Sequences for d2j0171:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0171 j.118.1.1 (7:1-49) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrkr

SCOP Domain Coordinates for d2j0171:

Click to download the PDB-style file with coordinates for d2j0171.
(The format of our PDB-style files is described here.)

Timeline for d2j0171: