Lineage for d2j01v1 (2j01 V:1-101)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813866Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 813867Superfamily b.155.1: L21p-like [141091] (1 family) (S)
  5. 813868Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 813869Protein Ribosomal protein L21p [141093] (3 species)
  7. 813909Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries)
    Uniprot P60492 1-101
  8. 813910Domain d2j01v1: 2j01 V:1-101 [145578]
    Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
    automatically matched to 2HGJ U:1-101

Details for d2j01v1

PDB Entry: 2j01 (more details), 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.
PDB Compounds: (V:) 50S ribosomal protein L21

SCOP Domain Sequences for d2j01v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j01v1 b.155.1.1 (V:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]}
mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae
vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg

SCOP Domain Coordinates for d2j01v1:

Click to download the PDB-style file with coordinates for d2j01v1.
(The format of our PDB-style files is described here.)

Timeline for d2j01v1: