SCOP 1.75: Domain d2j01d1: 2j01 D:127-273

Lineage for d2j01d1 (2j01 D:127-273)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Thermus thermophilus [TaxId:274] [159026] (5 PDB entries)
   Uniprot Q72I07 126-272

8. Domain d2j01d1: 2j01 D:127-273 [145564]
   Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0151, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1
   Representative structure

Details for d2j01d1

PDB Entry: 2j01, 2.8 Å

PDB Description: Structure of the Thermus thermophilus 70S ribosome complexed with mRNA, tRNA and paromomycin (PART 2 of 4). This file contains the 50S subunit from molecule I.

PDB Compounds: (D:) 50S ribosomal protein L2

SCOP Domain Sequences for d2j01d1:

Sequence; same for both SEQRES and ATOM records:

>d2j01d1 b.34.5.3 (D:127-273) C-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
vgnalplrfipvgtvvhavelepkkgaklaraagtsaqiqgregdyvilrlpsgelrkvh
gecyatvgavgnadhknivlgkagrsrwlgrrphvrgaamnpvdhphgggegraprgrpp
aspwgwqtkglktrkrrkpssrfiiar

Timeline for d2j01d1:

• d2j01d1 is new in SCOP 1.75
  
• d2j01d1 appears in SCOPe 2.01
  
• d2j01d1 appears in the current release, SCOPe 2.08