Lineage for d2i2um1 (2i2u M:1-113)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735303Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 2735304Protein Ribosomal protein S13 [46948] (2 species)
  7. 2735305Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 2735315Domain d2i2um1: 2i2u M:1-113 [145474]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2um1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2i2um1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2um1 a.156.1.1 (M:1-113) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprk

SCOPe Domain Coordinates for d2i2um1:

Click to download the PDB-style file with coordinates for d2i2um1.
(The format of our PDB-style files is described here.)

Timeline for d2i2um1: