Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) automatically mapped to Pfam PF00203 |
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
Protein Ribosomal protein S19 [54572] (2 species) |
Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
Domain d2i2us1: 2i2u S:2-80 [145480] Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2ut1, d2i2uu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2i2u (more details), 3.22 Å
SCOPe Domain Sequences for d2i2us1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2us1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv tdemvghklgefaptrtyr
Timeline for d2i2us1: