Lineage for d2i2uh1 (2i2u H:3-129)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978267Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2978268Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2978269Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2978270Protein Ribosomal protein S8 [56049] (4 species)
  7. 2978274Species Escherichia coli [TaxId:562] [111186] (9 PDB entries)
    Uniprot P02361
  8. 2978278Domain d2i2uh1: 2i2u H:3-129 [137006]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2uh1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2i2uh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2uh1 d.140.1.1 (H:3-129) Ribosomal protein S8 {Escherichia coli [TaxId: 562]}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyva

SCOPe Domain Coordinates for d2i2uh1:

Click to download the PDB-style file with coordinates for d2i2uh1.
(The format of our PDB-style files is described here.)

Timeline for d2i2uh1: