Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein) has a RRF/tRNA synthetase additional domain-like fold |
Protein Ribosomal protein S4 [55179] (3 species) also contains a Zn-binding N-terminal subdomain |
Species Escherichia coli [TaxId:562] [160439] (26 PDB entries) Uniprot P0A7V8 1-205 |
Domain d2i2ud1: 2i2u D:1-205 [145465] Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2i2u (more details), 3.22 Å
SCOPe Domain Sequences for d2i2ud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2ud1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]} arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt fkrkpersdlsadinehlivelysk
Timeline for d2i2ud1: