Lineage for d2i2ud1 (2i2u D:1-205)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864567Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 864568Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 864569Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 864570Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 864574Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
    Uniprot P0A7V8 1-205
  8. 864592Domain d2i2ud1: 2i2u D:1-205 [145465]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    automatically matched to 2AVY D:1-205
    complexed with mg

Details for d2i2ud1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOP Domain Sequences for d2i2ud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2ud1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

SCOP Domain Coordinates for d2i2ud1:

Click to download the PDB-style file with coordinates for d2i2ud1.
(The format of our PDB-style files is described here.)

Timeline for d2i2ud1: