Lineage for d2i2up1 (2i2u P:1-80)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942074Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 2942075Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 2942076Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 2942077Protein Ribosomal protein S16 [54567] (3 species)
  7. 2942080Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 2942090Domain d2i2up1: 2i2u P:1-80 [145477]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2up1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2i2up1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2up1 d.27.1.1 (P:1-80) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnk

SCOPe Domain Coordinates for d2i2up1:

Click to download the PDB-style file with coordinates for d2i2up1.
(The format of our PDB-style files is described here.)

Timeline for d2i2up1: