Lineage for d2arjl2 (2arj L:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749525Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (10 PDB entries)
  8. 2749538Domain d2arjl2: 2arj L:108-211 [144836]
    Other proteins in same PDB: d2arja1, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl1, d2arjq_, d2arjr_
    automated match to d2arja2

Details for d2arjl2

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (L:) YTS 105.18 antigen binding region Light chain

SCOPe Domain Sequences for d2arjl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arjl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsmeqltsggasvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd
skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnr

SCOPe Domain Coordinates for d2arjl2:

Click to download the PDB-style file with coordinates for d2arjl2.
(The format of our PDB-style files is described here.)

Timeline for d2arjl2: