SCOPe 2.08: Domain d2arjl2: 2arj L:108-211

Lineage for d2arjl2 (2arj L:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (10 PDB entries)

8. Domain d2arjl2: 2arj L:108-211 [144836]
   Other proteins in same PDB: d2arja1, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl1, d2arjq_, d2arjr_
   automated match to d2arja2

Details for d2arjl2

PDB Entry: 2arj, 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab

PDB Compounds: (L:) YTS 105.18 antigen binding region Light chain

SCOPe Domain Sequences for d2arjl2:

Sequence; same for both SEQRES and ATOM records:

>d2arjl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
radaaptvsifppsmeqltsggasvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd
skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnr

Timeline for d2arjl2:

• d2arjl2 first appeared in SCOP 1.75
  
• d2arjl2 appears in SCOPe 2.07