![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88578] (5 PDB entries) |
![]() | Domain d2arjh2: 2arj H:114-228 [144834] Other proteins in same PDB: d2arja1, d2arja2, d2arjb1, d2arjh1, d2arjl1, d2arjl2, d2arjq_, d2arjr_ automated match to d2arjb2 |
PDB Entry: 2arj (more details), 2.88 Å
SCOPe Domain Sequences for d2arjh2:
Sequence, based on SEQRES records: (download)
>d2arjh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]} aqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsg lytltssvtsstwpsqtvtcnvahpasstkvdqkivpr
>d2arjh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Norway rat (Rattus norvegicus) [TaxId: 10116]} aqttapsvyplapgcgsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt ltssvtsstwpsqtvtcnvahpasstkvdqkivpr
Timeline for d2arjh2: