Lineage for d2arjb1 (2arj B:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740657Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 2740676Domain d2arjb1: 2arj B:1-113 [144831]
    Other proteins in same PDB: d2arja1, d2arja2, d2arjb2, d2arjh2, d2arjl1, d2arjl2, d2arjq_, d2arjr_

Details for d2arjb1

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (B:) YTS 105.18 antigen binding region Heavy chain

SCOPe Domain Sequences for d2arjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arjb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qvqlkesgpglvqpsqtlsltctvsgfsltsnsvhwvrqppgkglewmggiwgdgdtdyn
salksrlsisrdtsknqvflkmnslqtddtaiyfctpligswyfdfwgpgtmvtass

SCOPe Domain Coordinates for d2arjb1:

Click to download the PDB-style file with coordinates for d2arjb1.
(The format of our PDB-style files is described here.)

Timeline for d2arjb1: