![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [88568] (10 PDB entries) |
![]() | Domain d2arjl2: 2arj L:108-211 [144836] Other proteins in same PDB: d2arja1, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl1, d2arjq_, d2arjr_ automated match to d2arja2 |
PDB Entry: 2arj (more details), 2.88 Å
SCOPe Domain Sequences for d2arjl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2arjl2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]} radaaptvsifppsmeqltsggasvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqd skdstysmsstlsltkveyerhnlytcevvhktssspvvksfnr
Timeline for d2arjl2: