PDB entry 2arj

View 2arj on RCSB PDB site
Description: CD8alpha-alpha in complex with YTS 105.18 Fab
Class: Immune System
Keywords: Protein-protein complex, Antibody Fab, Immune system, Immunoglobulin domain
Deposited on 2005-08-19, released 2006-05-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.223
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YTS 105.18 antigen binding region Light chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ARJ (0-210)
    Domains in SCOPe 2.06: d2arja1, d2arja2
  • Chain 'B':
    Compound: YTS 105.18 antigen binding region Heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2arjb1, d2arjb2
  • Chain 'H':
    Compound: YTS 105.18 antigen binding region Heavy chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2arjh1, d2arjh2
  • Chain 'L':
    Compound: YTS 105.18 antigen binding region Light chain
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2ARJ (0-210)
    Domains in SCOPe 2.06: d2arjl1, d2arjl2
  • Chain 'Q':
    Compound: T-cell surface glycoprotein CD8 alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: Cd8a, Lyt-2, Lyt2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2arjq_
  • Chain 'R':
    Compound: T-cell surface glycoprotein CD8 alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: Cd8a, Lyt-2, Lyt2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2arjr_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2arjA (A:)
    divmtqspsslavsagervtlnckasqnvrnniawyqqkpgqspklliyyasyrytgvpd
    rftgdgfgtdftlainsvqaddaafyycqriynspytfgagtkleliradaaptvsifpp
    smeqltsggasvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqdskdstysmsstls
    ltkveyerhnlytcevvhktssspvvksfnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2arjB (B:)
    qvqlkesgpglvqpsqtlsltctvsgfsltsnsvhwvrqppgkglewmggiwgdgdtdyn
    salksrlsisrdtsknqvflkmnslqtddtaiyfctpligswyfdfwgpgtmvtassaqt
    tapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
    ltssvtsstwpsqtvtcnvahpasstkvdqkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arjB (B:)
    qvqlkesgpglvqpsqtlsltctvsgfsltsnsvhwvrqppgkglewmggiwgdgdtdyn
    salksrlsisrdtsknqvflkmnslqtddtaiyfctpligswyfdfwgpgtmvtassaqt
    tapsvyplapgcgsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglytlts
    svtsstwpsqtvtcnvahpasstkvdqkivpr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2arjH (H:)
    qvqlkesgpglvqpsqtlsltctvsgfsltsnsvhwvrqppgkglewmggiwgdgdtdyn
    salksrlsisrdtsknqvflkmnslqtddtaiyfctpligswyfdfwgpgtmvtassaqt
    tapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
    ltssvtsstwpsqtvtcnvahpasstkvdqkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arjH (H:)
    qvqlkesgpglvqpsqtlsltctvsgfsltsnsvhwvrqppgkglewmggiwgdgdtdyn
    salksrlsisrdtsknqvflkmnslqtddtaiyfctpligswyfdfwgpgtmvtassaqt
    tapsvyplapgcgsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglytlts
    svtsstwpsqtvtcnvahpasstkvdqkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2arjL (L:)
    divmtqspsslavsagervtlnckasqnvrnniawyqqkpgqspklliyyasyrytgvpd
    rftgdgfgtdftlainsvqaddaafyycqriynspytfgagtkleliradaaptvsifpp
    smeqltsggasvvcfvnnfyprdisvkwkidgseqrdgvldsvtdqdskdstysmsstls
    ltkveyerhnlytcevvhktssspvvksfnr
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2arjQ (Q:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arjQ (Q:)
    apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
    twdekklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2arjR (R:)
    kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
    nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
    kvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2arjR (R:)
    apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
    twdekklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvn